|
CNTF, rat recombinant
A potent neural factor promoting survivability and differentiation of neuronal cell types.
Product Overview
Alternate Name/Synonyms: rat CNTF, CNTF, h-CNTF, rh-CNTF, recombinant rat CNTF, recombinant CNTF
Gene Symbol: CNTF
Accession #: P26441
Gene ID: 1270
Source: E. coli
Appearance: Lyophilized protein
Physical Form Description: Lyophilized from 0.025 % NaHCO₃
Molecular Weight: 22.834 kDa
Purity by SDS-PAGE: ≥99%
Purity by HPLC: N/A
Endotoxin Level: N/A
Biological Activity: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile ddH₂O or 0.4 % NaHCO₃ adjusted to pH 8-9 to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein
Storage Temp.: -20°C
Shipping: Gel Pack
Background Information: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques
Amino Acid Sequence: AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEM-TEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDG-GLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Handling: Centrifuge the vial prior to opening
USAGE: For Research Use Only! Not For Use in Humans. |